SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0238463 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0238463
Domain Number 1 Region: 322-379
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 5.23e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00014
Further Details:      
 
Domain Number 2 Region: 6-48
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000105
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00054
Further Details:      
 
Weak hits

Sequence:  FBpp0238463
Domain Number - Region: 227-325
Classification Level Classification E-value
Superfamily ARM repeat 0.000345
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0238463   Gene: FBgn0211133   Transcript: FBtr0239971
Sequence length 379
Comment type=protein; loc=scaffold_13047:join(7916064..7916087,7917123..7917326,7917720..7918070,7918125..7918332,7918395..7918639,7918717..7918824); ID=FBpp0238463; name=Dvir\GJ24046-PA; parent=FBgn0211133,FBtr0239971; dbxref=FlyBase:FBpp0238463,FlyBase_Annotation_IDs:GJ24046-PA,GB_protein:EDW67237,REFSEQ:XP_002053717,FlyMine:FBpp0238463; MD5=2497eaea97769fd12823f04c3c3c6317; length=379; release=r1.2; species=Dvir;
Sequence
MALCQTSVLKVYHAVIEDVISNVRDAFLDEGVDEQVLQEMKQIWRNKLLASKAVELNPEP
GEPGHHPPPIVANNPKAANAKAKKAAAAAAASQQNNSGATGGISSSADSNKLASPSIAGK
STAIGAAAGGGMKNGIGAIKQEVTSQNPPPLHPTSGATMMQKQQAAAAGATSGGQTPIPI
VAQLDPNRIMPVNITLPSPPGSTNSESRVLTIQVPASALQENQLTQILTAHLISSIMSLP
TTLASSVLQQHVNAALSNANHQKNLALAKQLDGALDSSEEDESEESDDNVDNDDDDDLDK
DDDDDAEHEDAAEEEPLNSEDDVTDEDSAEVFDTDNVIVCQYDKITRSRNKWKFYLKDGI
MNMRGKDYVFQKSNGDAEW
Download sequence
Identical sequences B4M009
FBpp0238463 XP_002053717.1.90633 7244.FBpp0238463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]