SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0225437 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225437
Domain Number 1 Region: 1011-1119
Classification Level Classification E-value
Superfamily PDZ domain-like 1.05e-24
Family PDZ domain 0.00015
Further Details:      
 
Domain Number 2 Region: 262-352
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-24
Family Ras-binding domain, RBD 0.00018
Further Details:      
 
Domain Number 3 Region: 380-474
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.18e-20
Family FHA domain 0.00039
Further Details:      
 
Domain Number 4 Region: 40-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.91e-18
Family Ras-binding domain, RBD 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225437   Gene: FBgn0198287   Transcript: FBtr0226945
Sequence length 2106
Comment type=protein; loc=scaffold_12855:join(7870951..7871055,7871114..7871222,7871297..7871490,7872049..7872582,7872652..7872733,7887261..7887613,7890041..7890162,7890653..7890707,7890781..7891061,7891396..7891608,7893207..7893672,7893759..7894283,7894355..7894602,7894665..7894783,7898565..7898858,7898980..7899196,7900476..7902564,7902642..7902763,7902829..7903021); ID=FBpp0225437; name=Dvir\GJ11020-PA; parent=FBgn0198287,FBtr0226945; dbxref=FlyBase:FBpp0225437,FlyBase_Annotation_IDs:GJ11020-PA,GB_protein:EDW59694,REFSEQ:XP_002056582,FlyMine:FBpp0225437; MD5=2b2683a4582d427b66ec56155402939b; length=2106; release=r1.2; species=Dvir;
Sequence
MSHDKKMLDREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIR
VASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHID
DREGRFLLKNIDQKTTPIEQSELNFKRKLSKREKKELKKKDKLAKLSSDVPLSNGSQLGM
GNGVGSLAGGASHMNGSTSGGAGGGGGDAGDAVAGKLYTELPETSFTRSISNPEAVMRRR
RQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLSKY
GLEKADPLHYCLVQVNSDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRR
KKKPLGSANGANHMSGDREGPVLVEVTHSGDGGRRIKLGSDPVEVGSANTNCLQLFGPSI
QPRHCLISLLEGVCTVTPLHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRFLDSPTD
GRYNLALSQSQLDSACLYESRSPTSPGSWNDEDGALSSTQKSEYEPHQQLNHSSAGYHSS
SAETQPLHNLRDVVDSKHGGQEQQQQQQQQQQQQLTSPGGGNYDGQSLEGNLENEIKSIS
SMKSNGSNSQDRSPKLPGAGGLLSGAGGSGSGDVQGQEPILPAVLEFPETHQENFLRHII
SELDVNVPHFKLAPVYSLYLCARYRASTHYRPELQPTERAHKLTIFLHHVANLVYGVVQE
QYTDPRILAFWMANSSEFLHFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQ
TLNQFLSETIDHDSAAGLVLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIV
ANSHMCTGEWGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQ
LACSCFRLNSLQMGALLQQEKIPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLA
LLLPDDGFSCDVVRGIPTGLVDFLNPLQQQSMCRLAAQPTSIGLWTVYMHQFNARSSSAM
SNKLPQPEVQLIKLHKNSNGMGLSIVAAKGAGQERLGIYIKSVVPGGAADADGRLQAGDQ
LLRVDGQSLIGITQERAADYLVRTGPVVSLEVAKQGAIYHGLATLLQQPSPVIQRGNRRM
SERDLSRMGGAESSKSLGGIGGPLIANSHTSHSLNQHLNLSNSNINSSHSHSHSHSHNNN
NHISGSIMSPLAAHLPNSKSVPALHHHTGSGNISLANSKSRSTHSLHNNAGGGGVLGGQA
NGSHNNPNPNSNPNANGNGNGNEQGFYQNLSVYRAQNQSQPILNERPSMSAHAAMSAYNG
TSPHAAALQQQQQQQQQQQQQQASPYQQHLQASANLPSRPVSAYYHSQQSAQQQLQQQHQ
QQQQHALQQQQFAHSSNNLNGQQQQQQLTLNNRAKSQQNFQHTLRMQQMLAPSMPNISNM
YQQQHQQHQQQQQQQQQQQQQVSSSQSMQNVNEYVAGYQNGGLDYQQHARRSQLHEAAAL
YELQHQQLQQQQQQQASPNFITLPPKPIGSLQSPSKPAGPPSTAPKPQQQQRLQQQQQQQ
AAGYLASHVLGEDKPPLPPTATHPLFKATQQQLTPGMNYVASTLDPPKGSYLPANQTAPR
SLHSGGNPWEREEREKDLEMRREHIRQWREQQIAELSAILARSPQQEEQLKTLILERDFE
RRAQELQEQEEDQDQPYDKDNVQELFRLSSSGVQVSAIQTPITSYRQTEIKLAEINESSS
VEPAAPSPAATATATAAGTPTAAGTQQPKSILKHNRYSEGGSGSSSAGAPSSPSKSQKSA
SFADERHLQTEHPISSLAKELTQLTMLDKDNNNETAAVDGSVPPPPPPERNSSYLIMSQQ
KMRTSVGGSSSSSSMGLLKTATSNQAAAVEVKKAAMHGATNNNNNNNLSGSLNNNTMQAS
PLSAMELNAAYVSATGTGMSMGTPPPPLLQRDNKRVSFHDEDNNLLGIQQQQQQQQLQQQ
QYLLDSYALEHQDLDTIREDASYIQHNMDASMLPSMPATPDAALWNTSVQSTPGVIGAQE
VYRDPRTRRLAEKQQQQQQQRAGDAVPEKLSFKEKMKMFALESGEDNTPKDKLKISRAQR
DIDAVH
Download sequence
Identical sequences B4M4Y3
FBpp0225437 7244.FBpp0225437 XP_002056582.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]