SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0225731 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0225731
Domain Number 1 Region: 476-558
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000647
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0225731   Gene: FBgn0198574   Transcript: FBtr0227239
Sequence length 611
Comment type=protein; loc=scaffold_13049:complement(23072588..23072703,23072766..23072945,23073001..23073673,23073740..23074015,23074076..23074666); ID=FBpp0225731; name=Dvir\GJ11314-PA; parent=FBgn0198574,FBtr0227239; dbxref=FlyBase:FBpp0225731,FlyBase_Annotation_IDs:GJ11314-PA,GB_protein:EDW70857,REFSEQ:XP_002048515,FlyMine:FBpp0225731; MD5=ec9f5ac61fa36a9aab9b2b8b8b36f894; length=611; release=r1.2; species=Dvir;
Sequence
MPPKSLTVLLPGLKWLQGYTAQDAVADLIAGITVGLTVLPQGLAYATLAGLEPQYGLYSS
FVGGIVYALLGSCRQVTIGPTALLALMTSRHTGFGLDSGPAYGILLCLISGVVELAMAVL
KLGALVDLISLPVTVGFTSATAVIIGTSQLKGLLGLRGGSGSDFINTMRSVFGNLHQVRR
GDLTLGLVSILVLLLLRRLKSVNLANRVHNLRAQQLLSGSIWVASTGRNALVVLISSGLA
YSQCKHLDACPFILTGKVKSGLPSLALPKFETRILGTNGTEEPQGFEQMLSELGPSMLIL
PVIAVLGNVAISKAFGGAGLSPTRELVALSLSNICGSFCSSMPVTGSFSRSAVNHASGVR
TPIGGCYTSLLVLLALGLLAPFFQYIPKAALSAVIISAVIFMIEFEVIRPLWRCSRRELL
PGAITFVMSLAVGVEIGLLLGVGTDVAFLVYRAARPVLSVSKLQTINGISYILIRPKHSS
LYFPAIEWVRSGISKAISTHGTAPVVLDCAHVHDVDFTAARGMGSLQKELAKANVPLFLM
SAHKDISVILKESTNIDFPTIDCANDLECILEHTPDYELHLQMTVPLVESKMLQNADEKP
TELSKLTSKIT
Download sequence
Identical sequences B4LC29
XP_002048515.1.90633 XP_015030412.1.90633 FBpp0225731 7244.FBpp0225731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]