SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0226503 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0226503
Domain Number 1 Region: 477-571
Classification Level Classification E-value
Superfamily TAFH domain-like 1.14e-32
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 901-950
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000356
Family TBP-associated factors, TAFs 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0226503   Gene: FBgn0199338   Transcript: FBtr0228011
Sequence length 1111
Comment type=protein; loc=scaffold_13049:complement(9446269..9446427,9446502..9446627,9446689..9446862,9446924..9447844,9447904..9448119,9448180..9448293,9448355..9448834,9449667..9450368,9450642..9450806,9451883..9452161); ID=FBpp0226503; name=Dvir\GJ12086-PA; parent=FBgn0199338,FBtr0228011; dbxref=FlyBase:FBpp0226503,FlyBase_Annotation_IDs:GJ12086-PA,GB_protein:EDW69500,REFSEQ:XP_002047158,FlyMine:FBpp0226503; MD5=0415e55fc9ae9b2f0714914ff925a9d3; length=1111; release=r1.2; species=Dvir;
Sequence
MNSSQTAPTATSANSNRITFTTQPLPNGTINIGGPGGGGVGPTIISTAQLPNTTTIKTIT
AGIGGHGVPGLSQVQHQVHQQSHQQQQQQQTQSTGQPLLNSMLPAGVVVGMRPQAPTQQQ
PKNMPANPLSRVVISNSHMGGVRPQSPSITLGTLNTGQTPALLVKTDNGFQLLRVGTATS
TGPPTMTQTISNTSNNNNNNNNNNNNTTTTTTNHPITTQIRLQTVPAAAVSRYHGQSSSQ
QQQQQQQQTQLQQQQQQQQHQTTTQASSQATTASTSIALRKTIVRTSSTILPSSNNNVNN
ITTNTTTTTTTNNNNNNNKPATNLQQQQQQQKLQLQLKQQQQAQQQHKQQQQQASASASS
AAAAAAAAAAANVAATIKIKQNSMTSTTASSNIIVNSVASSNAHSFSSASHPPHLAQLQQ
QHQQQQQQPHLPQVTQIQTIPAAQPHSQANNVQVASAAAATAVANANATTTTAAQGNTKE
KCRKFLANLIELSTREPKPVEKNVRTLIQELVNANVEPEEFCDRLERLLNASPQPCLIGF
LKKSLPLLRQALYTKELVIEGIKPPPQHVLGLAGLPPQLPKIQAQIRPIGLSQTTTIGQT
QVRMITPNALGTPRPTIGHTTISKQPPNIRLPTAPRLAIRGQMPSLPMPAQANIVQIRGP
HNAQLQRPGSVQIRATSRPPNSTPTNKVTAVKVGQTQIKAITSSLHPPSLAAISSNSGPP
PTPTLSVLSTINSASTTSLPVPSLPTVHLPPEALRAREQMQNSLHHNNNNHFEPKLVEIK
APQLPHMERINASLTPISAKTMPRGTMPMANKSANKKKRDAIDRDSKDERANSGSGMAGS
AAAAAANSFFQQSSMSSSIYGDDDINDVAAMGGVNLAEESQRILGCTENIGTQIRSCKDE
VFLNLPALQARIRAITAERGLDEPSQDVAVLISHACQERLKNIVEKLAVIAEHRIDVIKL
DPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRTRVEDPEQAKMKARAKE
MQRAEMEELRQRDANLTALQAIGPRKKLKLDSDAAGVGVGSSGGGLLSNSGTATTTLRPR
IKRVNLRDMLFFMEQEREFCRSSLLFKTYLK
Download sequence
Identical sequences FBpp0226503 7244.FBpp0226503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]