SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0236505 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0236505
Domain Number 1 Region: 52-196
Classification Level Classification E-value
Superfamily CBS-domain pair 2.51e-16
Family CBS-domain pair 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0236505   Gene: FBgn0209202   Transcript: FBtr0238013
Sequence length 441
Comment type=protein; loc=scaffold_12963:complement(13968920..13969488,13969885..13970530,13970594..13970704); ID=FBpp0236505; name=Dvir\GJ22088-PA; parent=FBgn0209202,FBtr0238013; dbxref=FlyBase:FBpp0236505,FlyBase_Annotation_IDs:GJ22088-PA,GB_protein:EDW64521,REFSEQ:XP_002052366,FlyMine:FBpp0236505; MD5=fa90bd90a69e9b7c46dbe5b234d13b28; length=441; release=r1.2; species=Dvir;
Sequence
MAITAPLSYPISRVLDALLGEEIGNVFNRERLKELVRVTNDVNDLDKNEVNIISGALELR
KKTVADIMTHINDAYMLSLDAVLDFETVSDIMNSGYSRIPVYDGDRKNIVTLLYIKDLAF
VDTDDNTPLKTLCEFYQNPVHFVFEDYTLDVMFNQFKEGTIGHIAFVHRVNSEGDGDPFY
ETVGLVTLEDVIEELIQAEIVDETDVFVDNRTKTRRSRYKKADFSAFAERREAQTVHISP
QLTLATFQYLSTDVVDSPTQMGSMQSLNMDAKIRQTFVPDYSVRASGDVIYIAIKRSLYL
TAKKATLLEKSRKSGTFSSETFDDEVERLLHSITEDEKPRFLTASQSARRASKPTRSATS
SPTNNTLSHDDRSNSASGQIPTGHRTGPEPTEDGSFSSLVTSDVAGDIQNGDNEDRDGTA
ASTPLLPKPEESNESRQNKPQ
Download sequence
Identical sequences 7244.FBpp0236505 FBpp0236505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]