SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428778417|ref|YP_007170203.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778417|ref|YP_007170203.1|
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 8.94e-53
Family Spore coat polysaccharide biosynthesis protein SpsA 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428778417|ref|YP_007170203.1|
Sequence length 304
Comment glycosyltransferase [Dactylococcopsis salina PCC 8305]
Sequence
MLFSIVIPTYNRKPILEKCIQALENQVITDSNLISDYEIIIVDDGSTDETISWLKQKAFP
HLRWFQQDHQGPATARNLGVEKANGEIIVFIDSDLVVTETFLQAHAHALNSSIDRAFTYG
RVINTSNFENPTAEPYKLTDFSAAYFATGNVAIHRQWLEKAGLFDPQFQLYGWEDLELGV
RLKKLGLKLIKCPDAVGYHWHPPFSLEQLPRLIQQEIDRGKMGVVFYEKHPTWEVKMMIQ
MTIFHRLLWGILSGGGRLNEKTMSPLLQWLINQGKPQLALEIARIFLNWYNVQAVSGKIP
LSKP
Download sequence
Identical sequences K9YPI0
gi|428778417|ref|YP_007170203.1| WP_015227859.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]