SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428778582|ref|YP_007170368.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778582|ref|YP_007170368.1|
Domain Number 1 Region: 309-558
Classification Level Classification E-value
Superfamily EAL domain-like 9.02e-88
Family EAL domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1-158
Classification Level Classification E-value
Superfamily CheY-like 3.98e-35
Family CheY-related 0.0015
Further Details:      
 
Domain Number 3 Region: 142-295
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.14e-28
Family GGDEF domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428778582|ref|YP_007170368.1|
Sequence length 563
Comment diguanylate cyclase [Dactylococcopsis salina PCC 8305]
Sequence
MKKILIMDDDFSVRESLQELLRGEGFQILWAIDGATGIKTAQNSEPDLILCDLLKSDLDG
YQVLSRIRESLATQTIPFIFLSTESELLNFRKAMTLGADDYLTKPFRREDLLAAIKSQFQ
KKAAFEQKYQTQNFEAINYDQLTGLPNRLLIRQQFENLQNADFLAILCVSLDRFQELKDY
FGYEVGESLLKQAVTRFKSVISSQDTLAYLSTNEFLIILTEASNTEETITVTEKVLSVFQ
PSFSVEEQEFSTTLSIGISFYPEHSREIDLLLKQSHKGKKSAEKKGGNCYHIYQPSLNKC
HSDYTITLETDLRYALEKQELVLYYQPRVSLVSGEIVGMEALLRWFHPQLGTISPKQFIP
IAEETGLIIPISDWVSEMACQQGKTWQNWLKRPLKMAINFSAQGFQLSDFCERIEAICQR
TQFPFSCLELELTESTLVKDFLQAREKLQQLQTLGIDVAIDDFGTGYSSLNYLQQFSFQI
LKLDRTFVRNSGRDTTNRAIVSSLIQLAHNLQLSVVAEGVERQCELNFLREQNCEEIQGY
LFSPPLSAREMEDLLREKRRLPS
Download sequence
Identical sequences K9YQ03
WP_015228024.1.8022 gi|428778582|ref|YP_007170368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]