SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428778600|ref|YP_007170386.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778600|ref|YP_007170386.1|
Domain Number 1 Region: 422-606
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.37e-38
Family Histidine kinase 0.00000626
Further Details:      
 
Domain Number 2 Region: 785-902
Classification Level Classification E-value
Superfamily CheY-like 2.56e-32
Family CheY-related 0.0013
Further Details:      
 
Domain Number 3 Region: 607-751
Classification Level Classification E-value
Superfamily CheW-like 8.63e-19
Family CheW-like 0.00089
Further Details:      
 
Domain Number 4 Region: 12-116
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.0000000053
Family Chemotaxis protein CheA P1 domain 0.013
Further Details:      
 
Domain Number 5 Region: 258-314
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000161
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428778600|ref|YP_007170386.1|
Sequence length 910
Comment chemotaxis protein histidine kinase-like protein [Dactylococcopsis salina PCC 8305]
Sequence
MQRNQPQNLDRNQYLEQAKTHLETIERGLLNLSGVIKPPETLQILYQAAEFINTGAVTHE
METIQQIAQFFEDCFGVMRTASVVSDKHLEELLWRVFDTFQGLVDMHAMSQAPTEYTKQV
EQEVYKGLQPTLNEARNYLKTRILHEEAEENPESLTLFQEEEAPTLIEGYNQQVVETTAN
AFPDYLGMNHLSEVIEASPQAEEQTLDVTAIEVYIEEAPRLTTEPEAVSPTAKEEEPATP
TVAPAPTPAKAGASLFEQTIKVPARLMDNLNNLIGELVVNRNSLEQDQERLRRFLDNLLE
QVSNLNDLGVRMQDLYERSLLENSLLASKSNSIRRLTTVSANGNDGGNRSNSEQNHQAEY
DPLEMDRFSGFHLLSQEMIELIVRVRESTSDLEFLVDEVEQEARIFRQVTTSLQEGFTAA
RMVPFSEVADRLPRAVRNISLKLNKKAKLQVEGKDTLVDKVILEELYDPMTHLVNNAIAH
GVESPEERINNGKPEAGVIKVKAHHQGNNSIISISDDGAGLDPIRIRRKAVEKGLISEAD
ARSLPDIDIFDFIFHPGFSTKDQADDLAGRGVGMDVVHSSLSKLRGSINIDSTPGKGTKF
LINLPLTLSITTALCCQLNQSSIAFPMDGVEDKFETSKENIKVNQKGERFIRWQRSSTLL
PFKHLSELLSYNRTLTRTNVFAAQSETDEISVVVLRSTGNLIAVQVDQVLGQQEIVIKQL
SGPVPKPVGVSGATVTSDGTVMTIADVLELIALFYGRVRKDVMTAMRAQQEKASQLEEGE
AEPMVLIVDDSITVRELLSMTFSKAGYRVEQARDGKEAWEKLRAGLACDMMFCDIEMPRM
DGLELLSRIKEEERFAELPIGMLTSRGAERHRQMASRLGAKGYFTKPYLEEVLLDAAKRM
LRGENFKNSR
Download sequence
Identical sequences K9YQ64
WP_015228042.1.8022 gi|428778600|ref|YP_007170386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]