SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428778642|ref|YP_007170428.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778642|ref|YP_007170428.1|
Domain Number 1 Region: 9-245
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.56e-21
Family Spore coat polysaccharide biosynthesis protein SpsA 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428778642|ref|YP_007170428.1|
Sequence length 313
Comment hypothetical protein Dacsa_0264 [Dactylococcopsis salina PCC 8305]
Sequence
MESNLKLKTPVLLLTFNRLDSTKEVLKAISKAQPSSIYIASDGPRPDRVGEAEKVQEVRD
YVISNINWDGDVKTLFREENLGCRVAVSGAIDWFFEHESEGIILEDDCVPDASFFPYVEE
LLNRYRDDERIMVIAGNHFPGKAHQPPYSYFFSRYNHCWGWATWRRAWQHYDHDMSQWPK
LRNTNWLLTIGDGNRNFQRYWTRIFDQAYAQKVDSWAYRWTFSCWAQSGLTILPALNLVK
NIGFDENATHTKSKNGSHKLSTLPLESLTFPLSHPSNVIRDYEADRWTEKNHFKHNWNRY
IKSQLRRIVPSFS
Download sequence
Identical sequences K9YQ67
WP_015228084.1.8022 gi|428778642|ref|YP_007170428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]