SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428778687|ref|YP_007170473.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778687|ref|YP_007170473.1|
Domain Number 1 Region: 9-141
Classification Level Classification E-value
Superfamily CheY-like 7.4e-42
Family CheY-related 0.00055
Further Details:      
 
Domain Number 2 Region: 150-218
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 9.86e-20
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428778687|ref|YP_007170473.1|
Sequence length 219
Comment response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Dactylococcopsis salina PCC 8305]
Sequence
MQDKNRDQKPRQLLLVDDDPNLILLIQDYLEFQGYEVKSADNGQEVLDILEKYIPDLIIC
DIMMPDIDGYEMVERIREDSRISWIPVIFLSAKGQTTDRVKGLTKGADVYLVKPFEPEEL
VAQVESSLKQVNRFQERYESNVDLEEGAKIHVPNNVTLTRTETKVVQFVSEGLANREIAE
KLNVSQRTVESHVSNMLNKTRLHNRTELARWAIQNHLVH
Download sequence
Identical sequences A0A2K3BCJ6 K9YQB7
gi|428778687|ref|YP_007170473.1| WP_015228129.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]