SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428779229|ref|YP_007171015.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428779229|ref|YP_007171015.1|
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily Ribosome recycling factor, RRF 1.24e-67
Family Ribosome recycling factor, RRF 0.00000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428779229|ref|YP_007171015.1|
Sequence length 182
Comment ribosome recycling factor [Dactylococcopsis salina PCC 8305]
Sequence
MKLSDVETKMKKAIDATQQSFNSLRTGRANASVLDRVMVEYYGMETPLKSLANISTPDAT
TITIQPYDKGSLQQIEKAISMSDIGLTPNNDGEMVRLNIPPLTSDRRQELVKIAGKYAEE
GRVSIRNIRRDAIEEVRKAEKKHELSEDEARDIQDKIQKLTDKYVAKVDEILKAKEEDIS
TV
Download sequence
Identical sequences A0A2K3BSZ0 K9YU76
gi|428779229|ref|YP_007171015.1| WP_015228669.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]