SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428779237|ref|YP_007171023.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428779237|ref|YP_007171023.1|
Domain Number 1 Region: 73-225
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 4.87e-57
Family Sigma2 domain of RNA polymerase sigma factors 0.0000246
Further Details:      
 
Domain Number 2 Region: 285-386
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 2.99e-29
Family Sigma4 domain 0.00017
Further Details:      
 
Domain Number 3 Region: 228-301
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 1.09e-18
Family Sigma3 domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428779237|ref|YP_007171023.1|
Sequence length 388
Comment RNA polymerase sigma factor, cyanobacterial RpoD-like family [Dactylococcopsis salina PCC 8305]
Sequence
MVNALTNQQQKSELERLIEEQSHEAAQGNTVALEVEPADSDLEKEALLEAEPPEEAPQKI
EATTTKEDSKKKSYTEDSIRLYLQEIGRIRLLRADEEIELARKIADLSELERTRTELEAT
IGCEPTDEEWAEEVGQALPKFRRRLLLGRRAKEKMVQSNLRLVVSIAKKYMNRGLSFQDL
IQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIRLPVHLYETISRIK
KTTKILSQELARKPTEEEIAERMEMTIEKLRFIAKSAQLPISLETPIGKEEDSRLGDFIE
ADGETPEDEVSKSLLREDLEDVLDTLSPRERDVLRLRYGLEDGRMKTLEEIGQIFNVTRE
RIRQIEAKALRKLRHPNRNSILKEYIRT
Download sequence
Identical sequences K9YRT3
WP_015228677.1.8022 gi|428779237|ref|YP_007171023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]