SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428779390|ref|YP_007171176.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428779390|ref|YP_007171176.1|
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.44e-56
Family mannose-1-phosphate guanylyl transferase 0.0000157
Further Details:      
 
Domain Number 2 Region: 278-344
Classification Level Classification E-value
Superfamily Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain 0.0000000000000103
Family Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428779390|ref|YP_007171176.1|
Sequence length 353
Comment mannose-1-phosphate guanylyltransferase [Dactylococcopsis salina PCC 8305]
Sequence
MTISIIPVILAGGKGERFWPVSRRERPKQFLSLDGSGNTLLQATANRLLNLASGWEKIWV
ITSEMLASGVQEQLPELPPENCLVEPQGRDTAPAVAWATIEIAKRYGEDAVIGFFPADHW
IGNTVKFEATIEAAFDLALSEEVIVTLGMKPTYPSTGYGYIEQGEKIRDNHDISAYSVTR
FTEKPDHDTAESFIATERFSWNSGMFIFRAGVVLKELKQYAPDILTPLQEKGKVAYADLP
KNSIDYALMEKTQLATVIPTEFGWDDLGDWNALERLFKGDNENVEMGTHLGLDTKGTIVY
SSDSEQVVVTLGLEDVVIVRDRNVTLVVKKDRTQDIKKLLKELQADDRFDKFL
Download sequence
Identical sequences K9YSG1
gi|428779390|ref|YP_007171176.1| WP_015228828.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]