SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428779396|ref|YP_007171182.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428779396|ref|YP_007171182.1|
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.75e-38
Family N-terminal domain of MutM-like DNA repair proteins 0.00026
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.41e-28
Family Middle domain of MutM-like DNA repair proteins 0.001
Further Details:      
 
Domain Number 3 Region: 226-276
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000265
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428779396|ref|YP_007171182.1|
Sequence length 279
Comment formamidopyrimidine-DNA glycosylase Fpg [Dactylococcopsis salina PCC 8305]
Sequence
MPELPEVETVCRGLNELTQGQVFQGGEVLLKRSIAHPVSIEAFWSGLKNTKIQQWQRRGK
YLLAELSSGGWLGLHLRMSGQLLWVEQSEPLAKHTRVRFFFSEGKELRFIDLRTFGRVWW
VAPDVDLKTVITGLNNLGVEPFSPEFTPTYLGNKLKNRRCAIKTALLDQKVVAGIGNIYA
DETLFLGKISPLREAASLTSSEVEALQQAIISVLSTAIEEGGTTFNSFLNLLGVNGNYMG
RAWVYGREGEVCRECETVIQRCKINGRSSHFCPRCQDVR
Download sequence
Identical sequences K9YU08
WP_015228834.1.8022 gi|428779396|ref|YP_007171182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]