SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428779446|ref|YP_007171232.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428779446|ref|YP_007171232.1|
Domain Number - Region: 311-388
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 0.0105
Family MgtE membrane domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428779446|ref|YP_007171232.1|
Sequence length 391
Comment DevC protein [Dactylococcopsis salina PCC 8305]
Sequence
MFSPFQILRERTPIGFLQLKRDPMRLLTAIAGITFADILIFMQLGFADALYKSNTQYPRA
LQADLVILSTEAKNFGQLGTFTRRRLDQALDVPSVIAADPMYLGSIQWQNPQTREKASML
VVGQTPERPMLDLPEINEQLDTLRLPDTVLFDRASRGNYQELIALLEQGKPITTEIRSET
VTIRGLFTVGASFADDGALITSDQNFLRLFPRREAGTVSIGLIEMAAEANPEAVKLALEE
RLPQDVQVFTHPEYVEFELNDIQSESPIGFVFGLGSVMGFIVGMVIVYQVLSTDVNSHLG
EYATFRAMGYRNRYLLMIVFEEALILSVLGFIPGTVIALGAYQLTAAATALPIVGSVSRG
AIVFFLTFLMCVGSGAIATRRLQAADPADIF
Download sequence
Identical sequences K9YU56
WP_015228884.1.8022 gi|428779446|ref|YP_007171232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]