SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428779540|ref|YP_007171326.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428779540|ref|YP_007171326.1|
Domain Number 1 Region: 130-356
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.62e-18
Family Nucleotide and nucleoside kinases 0.084
Further Details:      
 
Weak hits

Sequence:  gi|428779540|ref|YP_007171326.1|
Domain Number - Region: 17-68
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.000275
Family Sigma3 domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428779540|ref|YP_007171326.1|
Sequence length 450
Comment hypothetical protein Dacsa_1272 [Dactylococcopsis salina PCC 8305]
Sequence
MIVDDAIALVDELLQPEGLNDLQASVFRYCWQGEGYQEIADALGYDSGYIRTVGSKLWQQ
LSDIMGKKVTKSNLHSVFRQYNQPSDQEKEISPQETIATPPEFPGLPLNANSLFYVDRHP
IEQRCAQEILQPGALIRIQAPKQMGKTSLLYRLLEHGRAHHYKTLRLSCQEATTESFTDL
NSFLRWLCRSAARKLKQTPNLEQYWDDDLSFAKSNCTEYFENYLLSNINTPIILGLDDIE
RVFAYPQIAQDFFPLLRVWHEEANEIDIWQNLRLIVVHSTEVYVPLDINQSPFNVGLPIY
LPELKLEQIQELALRYGLNCLDGNMGAEALRPLMEMVGGHPYLIQLTLYHIWENQQQKPL
VNLNNILRDAPTDAGIYGSHLRRLWETLNSSPYLCSAMKKVVSNDQSVTISPLAAYKLQS
MGLIKLAGNLVTTRYKLYQDYFRSRLELNP
Download sequence
Identical sequences K9YSV3
gi|428779540|ref|YP_007171326.1| WP_015228975.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]