SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428779641|ref|YP_007171427.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428779641|ref|YP_007171427.1|
Domain Number 1 Region: 210-433
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000000706
Family DPP6 N-terminal domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 92-248
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000412
Family DPP6 N-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428779641|ref|YP_007171427.1|
Sequence length 496
Comment hypothetical protein Dacsa_1376 [Dactylococcopsis salina PCC 8305]
Sequence
MAISHKLKPIDRAAITVIILLSFVLMGLLLSEKVCGTDCWFKAKANVREFSWEGQKISAE
DRGFILNFSRPMNRESVENNLKIEPQLPGKISWSGKRMAYTLDNPAPYGTEYKISILGAK
ETLGSEIKPFQETFRTRDRAFVYIGVNGEEKGRLILYNLTQQEKTILTPPRLVVNRFFSY
PDRSKILFGGTSRENWEQGKLDQKLYTVTTGINKTENPSGKIELILDNKTYQILEFELSP
DGEKIVVRRGKKEASGLGEISLWVIENQASPQKLETATGGDFIIPPDSKTVAIAQGQGVA
LISLEKDSNPSNFLPQYGQVLTFSPDGTAAAMVNFNTQDTEKQYIRSLYLVTNRNVEKNL
LNTNGSILSCEFNPTVTHIYCLLTELIEGEQYQEKPYLVSINLETAAVTPLLTLPEYRDV
KMSLSPDGLALLFDQIMTVRETSETTVKTLRSDSGEAIIGSRLWLLVPTPTLTKDPNQKP
QLEELPISGLSPFWLP
Download sequence
Identical sequences K9YUP1
gi|428779641|ref|YP_007171427.1| WP_015229075.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]