SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428779719|ref|YP_007171505.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428779719|ref|YP_007171505.1|
Domain Number 1 Region: 200-265
Classification Level Classification E-value
Superfamily PGBD-like 1.07e-19
Family Peptidoglycan binding domain, PGBD 0.0053
Further Details:      
 
Domain Number 2 Region: 12-84
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0000209
Family GIY-YIG endonuclease 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428779719|ref|YP_007171505.1|
Sequence length 269
Comment peptidoglycan-binding domain-containing protein [Dactylococcopsis salina PCC 8305]
Sequence
MINWKTLPRERGIYQITTGSVSYVGLSDNIQLRVKQHLDSSSCRSRIIFDTDQAKIIVLE
LLPDTDDKTLALREWYWFSKLKRKGHIMVNDPKTLGKTKTGQFFPPKNVSQKTASSPSSG
LGCGVKLAGVTTVIVGFFLLGFFAVGKMIQQTEPSPQPDTTENPSPKPPVPSSRLSRNQD
NKSTQQNSQVDMQLLSACITPLQSGTSKPVVKLLQRQLKELGYYEGEIDGQYGPGTQDAV
SEFQRDYDLGVDGIVGCDTQAKINEAIRN
Download sequence
Identical sequences K9YVM0
gi|428779719|ref|YP_007171505.1| WP_015229152.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]