SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428779759|ref|YP_007171545.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428779759|ref|YP_007171545.1|
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily CheY-like 8.11e-25
Family CheY-related 0.0011
Further Details:      
 
Domain Number 2 Region: 130-225
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 9.78e-25
Family PhoB-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428779759|ref|YP_007171545.1|
Sequence length 248
Comment response regulator with CheY-like receiver domain and winged-helix DNA-binding domain [Dactylococcopsis salina PCC 8305]
Sequence
MKSISIHIIEGNPHLRSLLGWHLQQAKFSVRRSGSIQQAKPFLEAGQLILVILDADLSDG
ESLEFCYWLHCYSQSLILMLSARGAESDIVAGLKAGADDYLVKPFGMREFMARVEALSRR
FREVNVPLLLDYGQLKINLAQRKVYLQGKKVEFTPQEFSLLYVLAQAQGIALSRLELLRR
AWPEAIDNLRTIDTHILSLRKKLEINPKQPQLIQTVRNVGYRLNLELLQQESARSIPKPL
SLHESKLS
Download sequence
Identical sequences K9YVS6
gi|428779759|ref|YP_007171545.1| WP_015229192.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]