SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428779827|ref|YP_007171613.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428779827|ref|YP_007171613.1|
Domain Number 1 Region: 4-156
Classification Level Classification E-value
Superfamily CheY-like 2.99e-40
Family CheY-related 0.00057
Further Details:      
 
Domain Number 2 Region: 192-356
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-34
Family Histidine kinase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428779827|ref|YP_007171613.1|
Sequence length 363
Comment histidine kinase [Dactylococcopsis salina PCC 8305]
Sequence
MNKSPSLLIVDDEPSNFDVIEALLEDENYQLYYAANATGALKLLEKNPVDVILLDVMMPE
IDGITLCSYLKENPDYQYIPIIMVTALTGKEDLGRCLEAGADDFISKPLSWIELRSRLHS
MLRIKQQYDDLQLLLRRREEMAEIIVHDLQNPVTSIVFSCEMLKSTELDSKQRNKLEQIT
VAGKRLEEQIQTLLTMAKLETRHLVLEPVYLRLKPLLEKLIQEFSIISIAKEIKIVSNLE
IENDWVCLDSHLFSRIVNNLLSNALKYSPRGKTIEVKLQETPDRVLLKVCDEGKGVSDSL
KEKIFQKYEIGVNHTDVNQTGLGLAFCQMAIEAHGGSIYVEDNQPQGAVFIVEFPRKTSA
ESH
Download sequence
Identical sequences K9YTJ9
gi|428779827|ref|YP_007171613.1| WP_015229254.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]