SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428779847|ref|YP_007171633.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428779847|ref|YP_007171633.1|
Domain Number 1 Region: 20-394
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 4.32e-125
Family Nqo4-like 0.0000000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428779847|ref|YP_007171633.1|
Sequence length 394
Comment NADH dehydrogenase I subunit D [Dactylococcopsis salina PCC 8305]
Sequence
MAKIETRTEPMVLNMGPHHPSMHGVLRLIVTLDGEDVVDCEPVIGYLHRGMEKIAENRTN
VMYVPYVSRWDYAAGMFNEAITVNAPEKLADIEVPKRAQYIRVIMLELNRIANHLLWLGP
FLADVGAQTPFFYIFRERELIYDLWEAASGSRLINNNYFRVGGVAVDLPYGWLDKCIDFC
DYFAEKVDEYEKLITNNPIFRRRLEGIGVITREEAINWGLSGPMLRGSGVKWDLRKVDHY
ECYDDFDWEIHWETAGDCFARYLVRVREMRESLKIIRQACAGIPGGPYENLEARRMAEGK
KSQWNDFDYQYIAKKMAPTFKIPEGEHYVRLESGKGELGIFLVGNDNVFPWRWKIRAPDF
NNLQILPHLLKGMKVADIMAILGSIDVIMGSVDR
Download sequence
Identical sequences A0A2K3A5U0 K9YTL7
gi|428779847|ref|YP_007171633.1| WP_015229274.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]