SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428779863|ref|YP_007171649.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428779863|ref|YP_007171649.1|
Domain Number 1 Region: 80-147
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 2.35e-31
Family Cyanase C-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.13e-17
Family Cyanase N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428779863|ref|YP_007171649.1|
Sequence length 147
Comment cyanate hydratase [Dactylococcopsis salina PCC 8305]
Sequence
MPVAEITEKLLAAKKEKGITFEDLEKQVGRDEVWIASVIYRQASADMEEAKKIVSALGLP
ESMAEPLTVPPMKGGLEPQVPTDPLVYRFYEIMQVYGMPVKDVIHEKFGDGIMSAIDFSI
EVDRVEDPKGDRVQITMCGKFLPYKKW
Download sequence
Identical sequences K9YUV7
WP_015229289.1.8022 gi|428779863|ref|YP_007171649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]