SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428780128|ref|YP_007171914.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428780128|ref|YP_007171914.1|
Domain Number 1 Region: 290-460
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 5.1e-48
Family MgtE membrane domain-like 0.0000216
Further Details:      
 
Domain Number 2 Region: 145-286
Classification Level Classification E-value
Superfamily CBS-domain pair 1.39e-35
Family CBS-domain pair 0.0000112
Further Details:      
 
Domain Number 3 Region: 20-143
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 4.58e-28
Family MgtE N-terminal domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428780128|ref|YP_007171914.1|
Sequence length 462
Comment Mg2+ transporter MgtE [Dactylococcopsis salina PCC 8305]
Sequence
MAESVSSIENTPHSEIPELVRNQLEALLEKNNLEGAKSLLVPVKAVDIAEAIENLPESMQ
AIAFRLLSKTEAIEVYEHLDSSVQQALIEEFKRQEVIEIVDQMSPDDRARLFDELPAKVV
RRLLAEMSPKERQNTALLLGYQEDTAGRIMTPEYISLKDSLTVEQTLQRIRNLANASEII
YYLYVTDASRHLTGIVSLRDLVLASPEAPLSAIVTREVVSVYTDTDQEEVARLIQRYDLL
AIPVVDREQRLVGVVTVDDVMDILEQETTEDIYTLGGVQSDGDNYFQTNLLAVARKRVVW
LFVLLLTNTVTGSIIQSQEDILQQVVTLAAFIPLLTGTGGNVGAQSSTVVIRGLNTDEIR
SLGVGYVIFREALAGALLGLILGSVATLWSFWLQGSLVVSIAVGLSLIAIAILASVAGSA
LPFLFRSLGLDPALMSAPFITTAVDVLGVLIYFNIARIVLDL
Download sequence
Identical sequences K9YVL3
WP_015229554.1.8022 gi|428780128|ref|YP_007171914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]