SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428780184|ref|YP_007171970.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428780184|ref|YP_007171970.1|
Domain Number 1 Region: 5-80,162-343
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 4.89e-98
Family Pyruvate kinase 0.00000325
Further Details:      
 
Domain Number 2 Region: 328-474
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 1.11e-38
Family Pyruvate kinase, C-terminal domain 0.00087
Further Details:      
 
Domain Number 3 Region: 469-583
Classification Level Classification E-value
Superfamily Phosphohistidine domain 4.71e-27
Family Pyruvate phosphate dikinase, central domain 0.014
Further Details:      
 
Domain Number 4 Region: 76-172
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 2.27e-24
Family Pyruvate kinase beta-barrel domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428780184|ref|YP_007171970.1|
Sequence length 601
Comment pyruvate kinase [Dactylococcopsis salina PCC 8305]
Sequence
MELQNSSRRTKIVATVGPATLKPDVLRDLIKAGATTLRLNFSHGTQEDHQSSIRLIRQTA
FELNQPVAILQDLQGPKIRLGKFENGSITLAKGDPFILTSHPMTGTQEKSYVSYDLLAEE
VPAGATILLDDGRVEMQVEAVYPEKKEVHGRVVVGGELSNNKGVNFPGVYLSVRALTDKD
RRDLMFGLDQGVDWIALSFVRNPQDVLEIKEIISSAGKSVPVIAKIEKHEAIEQMEAVLS
LCDGVMVARGDLGVELPAEDVPILQKRLIQTANRLGIPVITATQMLDSMANNARPTRAEV
SDVANAILDGTDAVMLSNETAVGKYPVEAVATMARIADRMEREKPTPSDKLDTTRTIPNA
ISSAVSQISRQLDAAAIMTLTKTGATARNVSKFRPQTPILAVTPHVDVARQLQLVWGVNP
LLVLDLPSTGQTFKAALNVAQEKGLVSDGDLVVMTAGTLQGVAGSTDLIKVEVVTAVLGR
GVGIGHGTVSGRARVAKSAREAGNFRPGEILVVPHTDADYVEAIRKATGIITEEGNLTSH
AAVIGLRLGIPVIVGFEGATQTIREGAILTLDSQRGLVFSGAVSAGGQFNENAGTGVPLP
S
Download sequence
Identical sequences K9YWX7
WP_015229609.1.8022 gi|428780184|ref|YP_007171970.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]