SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428780185|ref|YP_007171971.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428780185|ref|YP_007171971.1|
Domain Number 1 Region: 1-249,303-313
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.33e-70
Family Cytidylytransferase 0.037
Further Details:      
 
Domain Number 2 Region: 272-338
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.00000000000955
Family GlmU C-terminal domain-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428780185|ref|YP_007171971.1|
Sequence length 386
Comment Nucleoside-diphosphate-sugar pyrophosphorylase family protein [Dactylococcopsis salina PCC 8305]
Sequence
MKAMILAAGKGTRVRPITYTIPKPLIPILQKPVMEFLLELLRKHGFDEVMVNVSHLAHEI
ESYFRDGQRFGVDIAYSFEGRIVDGQLVGEALGSAGGIRRIQDFNKFFDDTFVVLCGDAL
IDLDLTEALKQHKEKGAIATVITKEVPKEKVSSYGVVVTDENNRITAFQEKPSVEEALST
QINTGIYILEPEAIAYIPSGQVYDLGSDLFPKLVERGAPFYSVPMNFQWVDIGKVPDYWH
AVRGVLLGEIKNVEIPGKEVAPGVYTGLNVAVNWDKVNITGPVYIGGMTRIEDGANIIGP
AMIGPNCWICSGATVKNSVIFEYSRLGPKVRLVDKLVFGRYCVDKTGTTIDVQAAALDWL
ITDSRQTPPKFELEEQEAIAQLLMGE
Download sequence
Identical sequences K9YUN6
WP_015229610.1.8022 gi|428780185|ref|YP_007171971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]