SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428780462|ref|YP_007172248.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428780462|ref|YP_007172248.1|
Domain Number - Region: 268-300
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0436
Family Sigma4 domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428780462|ref|YP_007172248.1|
Sequence length 308
Comment hypothetical protein Dacsa_2276 [Dactylococcopsis salina PCC 8305]
Sequence
MTRNLHDQFSKDSLEELLYSFGKSEVDSKVASEVREIDFFFTPDPDKKANLTALGFLGKL
ALTPAMIEPYRNPIDVKEVRKCLKKLLDLEASQQRRYRREQTPLSEQEAPTLWILSPTIS
NSVIEAFGAKPDLENWVEGFYFCGEGLRTVLVAVHQLPRTPDTLFLRIFGRGKVQMQALE
ELQQLPPSNPFRDRMLEIVANMVAILEVRQQEQQGLESEEREFLMQLSTVYTQRLQEAEQ
RGEERGVEQGIEQGIEQGIEQGVKLAQRRFIRNLLSRGMTIEEIAELTELSPEEVTQLIN
QDEQYSVS
Download sequence
Identical sequences K9YVE0
gi|428780462|ref|YP_007172248.1| WP_015229883.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]