SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428780485|ref|YP_007172271.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428780485|ref|YP_007172271.1|
Domain Number 1 Region: 15-165
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 9.42e-57
Family Sigma2 domain of RNA polymerase sigma factors 0.0000322
Further Details:      
 
Domain Number 2 Region: 227-318
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 1.7e-25
Family Sigma4 domain 0.0017
Further Details:      
 
Domain Number 3 Region: 169-243
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 4.8e-19
Family Sigma3 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428780485|ref|YP_007172271.1|
Sequence length 328
Comment RNA polymerase sigma factor, cyanobacterial RpoD-like family [Dactylococcopsis salina PCC 8305]
Sequence
MPTAKLDKNNDKPIFSADMVRTYLHEIGRVPLLTHEQEIILGKQVQKMMGLIEQKEELEK
ELEREVTEEEWVEKTELTSAELQKAIKDGNRAKRKMIEANLRLVVAIAKKYQKRNMEFLD
LIQEGTLGLERGVEKFDPTRGYKFSTYAYWWIRQAITRAIAQQARAIRLPIHITEKLNKI
KKVQRELAQKLGRNATPTEIAKELELEPSQIREYLSIARQPISLDVRVGDNQDTELSELL
EDDENSPETYLTQESMRQDIDSMLSELTPQQREVLSLRFGLEDGNELSLAKVGKKLNLSR
ERVRQLEHQALAKLRRRRGGVQEYIAAG
Download sequence
Identical sequences A0A2K3BLP3 K9YVJ3
WP_015229906.1.8022 gi|428780485|ref|YP_007172271.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]