SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428780544|ref|YP_007172330.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428780544|ref|YP_007172330.1|
Domain Number 1 Region: 4-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.15e-26
Family Thioltransferase 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428780544|ref|YP_007172330.1|
Sequence length 86
Comment glutaredoxin, GrxC family [Dactylococcopsis salina PCC 8305]
Sequence
MAANVEIYTWASCPFCLRAKALLTQKDIPFTEYSIDGDEDARDQMAQRANGKRSVPQIFI
DDHSIGGCDELYALEKDGKLDAMLSS
Download sequence
Identical sequences A0A2K2ZYL3 K9YXY2
WP_015229964.1.8022 gi|428780544|ref|YP_007172330.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]