SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428780600|ref|YP_007172386.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428780600|ref|YP_007172386.1|
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily CheY-like 7.26e-37
Family CheY-related 0.00059
Further Details:      
 
Domain Number 2 Region: 145-211
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 4.76e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428780600|ref|YP_007172386.1|
Sequence length 212
Comment response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Dactylococcopsis salina PCC 8305]
Sequence
MPLLILLAEDDPGIQMAVKDYLEFSGYSVITAKNGDEALHHLKTYHPHLIVADIKMPRKD
GFELIQEVRERPEFRMLPVIFLTQRGSTADRILGYEAGCDLYLPKPFEMAELGAVIKNLL
IRSQMEQSEQSINAQQGSIHSEEENHEDFHFTQRESEVLELLTQGLSNTEMGEKLYLSPR
TVEKYVSSLLRKTDTNNRAELVSFTLKHHLIS
Download sequence
Identical sequences K9YVV0
WP_015230020.1.8022 gi|428780600|ref|YP_007172386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]