SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428780779|ref|YP_007172565.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428780779|ref|YP_007172565.1|
Domain Number 1 Region: 183-374
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.31e-81
Family GroEL-like chaperone, apical domain 0.00000137
Further Details:      
 
Domain Number 2 Region: 6-133,404-521
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.15e-73
Family GroEL chaperone, ATPase domain 0.0000307
Further Details:      
 
Domain Number 3 Region: 140-202
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.21e-20
Family GroEL-like chaperone, intermediate domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428780779|ref|YP_007172565.1|
Sequence length 559
Comment chaperonin GroL [Dactylococcopsis salina PCC 8305]
Sequence
MAKIVTFNEKARRSLERGVNALADAIRITLGPKGRNVLLEKQYGNPQIVNDGITAAKEIE
LEDPLENTGARLILEVASKTNDMAGDGTTTATVLGQAMIREGLKNVAAGSNPVAIRRGIE
KTVNYLVEEIANVAKPVEGSAIAQVATVSAGNDEEIGKMIADAMERVTKDGVITVEESKS
LATELDVVEGMEIDRGYLSPYFITDQERQIVEFENPRILITDKKISAIQDLVPVLEQVAR
EGQPLLVIAEDIEGEALATLVVNKARGVLNVSAIKAPGFGDRRKQMLQDIAVLTGGQLVS
EDVGLTIDSVSLDMLGTARRVTINKDSTVIVSNGENKNDVEKRVNQIRKQLAETDSEYDK
EKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATQAAVEEGIVPGGGTTLIHL
AAKVAEFKNQLTHPEEKIGADLVGKALEAPLSQMADNAGAEGSVVVENVRETEFNVGYNA
LTGEYEDMIAAGIIDPAKVIRAALQNAGSIAGMIITTEALVVEEPQEEEAGGDPSAAMGG
MGGMGGMGGMGGMGGMGMM
Download sequence
Identical sequences K9YYP3
WP_015230198.1.8022 gi|428780779|ref|YP_007172565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]