SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428780830|ref|YP_007172616.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428780830|ref|YP_007172616.1|
Domain Number 1 Region: 6-81,172-345
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 2.6e-96
Family Pyruvate kinase 0.00000224
Further Details:      
 
Domain Number 2 Region: 328-473
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 3.92e-30
Family Pyruvate kinase, C-terminal domain 0.0061
Further Details:      
 
Domain Number 3 Region: 76-172
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 1.64e-24
Family Pyruvate kinase beta-barrel domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428780830|ref|YP_007172616.1|
Sequence length 477
Comment pyruvate kinase [Dactylococcopsis salina PCC 8305]
Sequence
MSVNSFSHRTKIVATIGPASQSEMVIRELVKAGMNVARLNFSHGSYDDHGRTIERLRKIS
TELDHPITLLQDLQGPKIRVGQLPKGEITLNAGEKVILIPNSIKENIANCIPIDYPHLAE
DAQPGAQVLLDDGNLELEVGKIEGTQVYCRVITGGILKSRKGVNFPNLNLSLPSLTAKDQ
EDLEFGIAQEIDWVCLSFVRGVEDIHCLKDFLKFREANIPVIAKIEKPQAIENFDELVKE
CDGMMVARGDLGVEMRPEKVPLLQKKIIQSCNKKGIPVITATQMLESMINSPRPTRAEAS
DVANAIIDGTDAIMLSGESAMGNYPIAAIKTMASIAEEIEPEVQFINYPPAEKTETHALS
ESLNCIDKIINLRCIACFTTTGYTARIASDERPKAPIVAFTPSLVVYHRLNLIWGVKPLL
LQPQEEGLEVLITEMESCLLQRNLVASGDKILILGGSPIQQAKGTNFLKIHTVSREN
Download sequence
Identical sequences K9YWI2
gi|428780830|ref|YP_007172616.1| WP_015230248.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]