SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428781083|ref|YP_007172869.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428781083|ref|YP_007172869.1|
Domain Number - Region: 22-128
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00889
Family Apolipoprotein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428781083|ref|YP_007172869.1|
Sequence length 134
Comment hypothetical protein Dacsa_2961 [Dactylococcopsis salina PCC 8305]
Sequence
MMIIVGIIIGLAGLAIGAGAVFVWKNNEVTQTKEKYQKQLEAQKKQLEQDHQRRIEETTK
LLQQNYQQQMEEQIQERVQQEVAVAQENAQAEVTQIRQELEQTRQQLAVQENYQAQVEEL
RKELESFLSERRRT
Download sequence
Identical sequences K9YYE1
WP_015230492.1.8022 gi|428781083|ref|YP_007172869.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]