SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428781295|ref|YP_007173081.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428781295|ref|YP_007173081.1|
Domain Number 1 Region: 450-470,526-763
Classification Level Classification E-value
Superfamily HAD-like 4.51e-55
Family Meta-cation ATPase, catalytic domain P 0.00024
Further Details:      
 
Domain Number 2 Region: 247-341
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-24
Family Calcium ATPase, transduction domain A 0.0045
Further Details:      
 
Domain Number 3 Region: 13-88
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 6.02e-18
Family HMA, heavy metal-associated domain 0.0015
Further Details:      
 
Domain Number 4 Region: 203-240,342-444
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000301
Family Calcium ATPase, transmembrane domain M 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428781295|ref|YP_007173081.1|
Sequence length 773
Comment copper/silver-translocating P-type ATPase [Dactylococcopsis salina PCC 8305]
Sequence
MQVSSKATSPVSQENKKTITLDVDGMKCAGCVNAVERQIEQQTGVIAAQVNLITATAIVQ
YQPDRADLEAIAAQLTAKGFPSQLHDTNQAEAGNSYEEKRQQADQENLQKLAIAGGLILL
SAIGHLKHLTGVEIPLLSNIWFHWGLATLALVLPGREIIIDGGKGLWNRVPNMNSLIALG
TLSAYIASCVALIFPQLGWECFFDEPVMLLGFILLGRTLEQRARGEAGAALSALVSLKPQ
TARLVKATPKQEDKMMEVPVGTVQVGQWLKVLPGEKFPVDGEVIKGETTVDESMLTGESM
PVRKQPEASVQAGTINLTGAVTLKATQVGKDTTLAKIIATVENAQMRKAPVQQLADQVAG
YFAYGVMAIALLTFLFWYSVGTNVWTAVTLETSPLLLSLKLMIAVLVIACPCALGLATPT
AILVGTGVGAKQGLLLKGGDVLENVHRLDTLVFDKTGTLTEGKPQVTDYWVVTTPDLQKE
TLLQFAASVEQGTNHPLAAAIVTEAEKQGVSLLPTADEETKAGFGASATIEQQNVIVGNS
QWLEEKGIVIPDSVALSGEKLEATGKTVVYVGINGALAGAIALKDCLRPDAIETVSQLQK
MGFRVIVLTGDQARVARAIVHALNLTTDNLIAGVHPEEKAQVIQSLQAQGQRVGMVGDGI
NDAPALAQADVGIAIAQGTDVALETASIILMRDRVSDVMTAIRLSLATLNKIRQNLFWAL
GYNVITIPLAAGVLLPKYNLLLSPAMAAALMALSSVIVVTNSLFLKRFRNAEE
Download sequence
Identical sequences K9YXV3
gi|428781295|ref|YP_007173081.1| WP_015230701.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]