SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428781425|ref|YP_007173211.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428781425|ref|YP_007173211.1|
Domain Number 1 Region: 438-458,501-750
Classification Level Classification E-value
Superfamily HAD-like 1.04e-58
Family Meta-cation ATPase, catalytic domain P 0.00016
Further Details:      
 
Domain Number 2 Region: 244-340
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.53e-29
Family Calcium ATPase, transduction domain A 0.0034
Further Details:      
 
Domain Number 3 Region: 5-81
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 4.06e-23
Family HMA, heavy metal-associated domain 0.00052
Further Details:      
 
Domain Number 4 Region: 200-244,341-434,692-725
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 7.85e-16
Family Calcium ATPase, transmembrane domain M 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428781425|ref|YP_007173211.1|
Sequence length 758
Comment copper/silver-translocating P-type ATPase [Dactylococcopsis salina PCC 8305]
Sequence
MSQTQSRTDTTTLKLQGMSCAGCANAIQKAINNVSGVEECEVNFASEQATVQFNPEKTSL
ETIQGAVEDAGYGASVYSQEDMMTGRGDAEIVAREAELKDLKRKIWVSGVISLILVVGSL
PMMTGLDLPFIPPWLHNYWLQFVLTTPVQFWCGSHFYRNAWKAFKNRAATMDTLVALGTS
AAYFYSLFATLFADFLIQQGLTPQVYYESAAVIITLILVGRFMENRARGETSQAIRKLIG
LQARSARVIRDGETKDIPIQEVEIGDMIQVRPGEKIPVDGEVTQGYSTVDESMVTGESIP
VEKSVGDEVIGSTINKTGSFQFQATRVGKDTVLSQIVQLVQQAQGSKAPIQNLADQVTGW
FVPVVIAIALLTFVLWFNIMGNVTLALINMVAVLIIACPCALGLATPTSVMVGTGKGAEN
GILIKSAESLETAQKLNTIVLDKTGTLTEGKPQVTDYVTTFGTSNQNELKLLRLVALLEQ
QSEHPLAEAVVDYAKSQQVQFNGIVEDFNAITGSGVQGTVSDRVVRVGTARWFNELGIKT
ETLAEKANQWEAAGKTVIWIAVDHELEGIMALADTLKPSSVDAVKALRTLGLEVVMMTGD
NEKTAASIAQQVGIPRVMSQVRPEQKAEQIVSLQQEGKQVAMVGDGINDAPALAQADIGI
AIGTGTDIAITTSDITLISGDLQGVITAIELSRATMTNIRQNLFFAFIYNVAGIPIAAGI
LYPIFGWLLNPIIAGAAMAFSSVSVLTNALRLRKFQTL
Download sequence
Identical sequences K9YY63
gi|428781425|ref|YP_007173211.1| WP_015230829.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]