SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428781527|ref|YP_007173313.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428781527|ref|YP_007173313.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.13e-38
Family Ribosomal protein S14 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428781527|ref|YP_007173313.1|
Sequence length 100
Comment 30S ribosomal protein S14 [Dactylococcopsis salina PCC 8305]
Sequence
MAKKAMIEREKKRQRLVEKYADKRAELKEQIRTSTSPRERFQLQRELQRLPRASSRTRLR
NRCQVTGRPRGYYRDFGLSRNVFREWAHNGYLPGVVKSSW
Download sequence
Identical sequences K9YYD0
WP_015230930.1.8022 gi|428781527|ref|YP_007173313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]