SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428781534|ref|YP_007173320.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428781534|ref|YP_007173320.1|
Domain Number 1 Region: 341-509
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.38e-43
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 268-353
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.85e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 3 Region: 527-653
Classification Level Classification E-value
Superfamily CheY-like 1.71e-18
Family CheY-related 0.0052
Further Details:      
 
Domain Number 4 Region: 21-132
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000142
Family CBS-domain pair 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|428781534|ref|YP_007173320.1|
Domain Number - Region: 812-882
Classification Level Classification E-value
Superfamily CheY-like 0.00226
Family CheY-related 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428781534|ref|YP_007173320.1|
Sequence length 928
Comment signal transduction histidine kinase [Dactylococcopsis salina PCC 8305]
Sequence
MEGKTPMSTVNPTLEQFIKFVPYCQSQNSLETMLSSFGDYNRDFLVVVNNNNIPLGIISA
GTALRAKTDNNYSFHGVTALLSPVSTVSEQLTLQQLLPYLERAATEEKFLVVDARGKLRG
ELDTESILQVLLRSQKPSPEKNFTSLLDFLDQFPLPLMLQTKEGKLLHKNSSWGEKICTQ
AENCCLLTPKLSEDVEKQWCNLISSPSVSTSRKVSGKNSRCPLFPLTMKDNLNIPGVWQF
TTLNLPNSELGSLWLVLATDISEQRQLCKELAAKNADLVQLNRLKDEFLACITHELKSPL
TAIVGLSNLMGEKSIGDLNERQQRYVKQIYQSGRQLMNLVNDLLDLARLETGQLQLHPEV
VNVKQVCDRAYEEARQQTPDFAPQFTFNLEPNLETIIADELRLRQMLVHLLANAQKFTAE
EGEMGLEVNAWEGWIAFTVWDTGMGIPEASQHLIFQKFQQLEDPMTRQFSGTGLGLVLTQ
RLAQAHGGDVSFISEEGKGSQFTLLLPPTPAPKPFPSQAHSQQQGGKLVLVVEAVPQYLK
EITKQLQELGYRVAIARSGTEALLKARTFQPCTILLNPVLPLLSGWDVLTLIKSHPSSCH
LPVVVTGTRGEKEEAMNNGADAFLTLPVAKGSLEDVLLACAAPRSPYRKCLTVLRLHYAD
LNAPPKRDRITEILSSPPETSPKNVNYRILEADDPEQAELLQRIWHPDVLLLTGDNIPRS
FITAISEQDTLPNLPLVCLETESARYAHQTGKLSVYPCLKPITSQHTLWSVLRFAAGISP
PPRKTAPYVVVADGKRLNQKVSVSPHRGSEWLNAFVQYLTTAGYRTSLSHSWEEVYQQAE
NQGADLLLLDLKGTESNAEAIAGLENLRSIEHLPIIAIAPPQQLLQDETLHQLLTEVATK
ILPNHPQSMLELLRILEEQMGNDNQSVG
Download sequence
Identical sequences K9Z0Q7
gi|428781534|ref|YP_007173320.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]