SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428781585|ref|YP_007173371.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428781585|ref|YP_007173371.1|
Domain Number 1 Region: 7-250
Classification Level Classification E-value
Superfamily HAD-like 5.41e-29
Family Phosphonoacetaldehyde hydrolase-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428781585|ref|YP_007173371.1|
Sequence length 263
Comment haloacid dehalogenase superfamily hydrolase [Dactylococcopsis salina PCC 8305]
Sequence
MSSPQAIVVFDIDGVVRDVAGSYRRALADTVEQLTNGAYRPTPDEIDDLKGEGIWNNDWE
ASRELVYRYFEAQGQSRRNLEVDYTELVAFFQSRYFGNDPERWDGYIADEPLLMSKDYLD
SLTEQKILWGFFSGATRDSAAYVLQRRLGLLSPVLFAMEDAPGKPDPTGLFATVEQLYTE
ESLPVFYVGDTVADMQTIVNARMVRPDRAWFAVGVLPPHVSAASRQRIEQYSAQLKAAGA
MMVLKNVEELTSEKVLMTRSNQY
Download sequence
Identical sequences K9YYK9
gi|428781585|ref|YP_007173371.1| WP_015230988.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]