SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428781638|ref|YP_007173424.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428781638|ref|YP_007173424.1|
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily N-terminal domain of the delta subunit of the F1F0-ATP synthase 3.4e-23
Family N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428781638|ref|YP_007173424.1|
Sequence length 187
Comment ATP synthase F1 subunit delta [Dactylococcopsis salina PCC 8305]
Sequence
MRENTLMSAEVVEPYASALMSLADSQNLIERFGNDAKELLAALKSSQDLKQFLANPVIKI
DDKKAVLRRITGEGLHQYLVNFLQLVVDKKRTAFLTGILEQFLALVRDRTSTVLAEVTSV
TELSNEQRDRVKERVKAMTNAQNVELETTLDPSLIGGVVIKVGSQVLDASLKGQLRRIGF
SLETTVS
Download sequence
Identical sequences A0A2K3BAM7 K9Z006
gi|428781638|ref|YP_007173424.1| WP_015231041.1.8022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]