SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428781724|ref|YP_007173510.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428781724|ref|YP_007173510.1|
Domain Number 1 Region: 54-175
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 6.28e-40
Family Insert subdomain of RNA polymerase alpha subunit 0.0000625
Further Details:      
 
Domain Number 2 Region: 6-54,176-230
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 8.54e-29
Family RNA polymerase alpha subunit dimerisation domain 0.0072
Further Details:      
 
Domain Number 3 Region: 249-304
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 6.54e-21
Family C-terminal domain of RNA polymerase alpha subunit 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428781724|ref|YP_007173510.1|
Sequence length 318
Comment DNA-directed RNA polymerase subunit alpha [Dactylococcopsis salina PCC 8305]
Sequence
MALLKDFTVDCVESKTDNKTQNQYSKFVLEPLERGQGLTVGNALRRVLLSNLEGTAVTAT
RIAGVTHEFATVPGVREDVLEILLNLKELVFRSYSPGPHIARLAATGPATITAGDFNLPS
EVEVVDPTGYVATLAEGAKLEMEIRIERGTGYRVVNLEKEDVSSLDFLQIDAVFMPVSKV
KYTVEETRIDDGENKDRLILEITTNGSVKPEEALSQAATILVGLFSPLGNLNIEPLPVEK
EEEEDPNGQIPIEELQLSVRAYNCLKRAQINSVADLLDYSHEDLLEIKNFGQKSAEEVVE
ALQDRLGITLPQEKSTAT
Download sequence
Identical sequences K9Z1B7
WP_015231126.1.8022 gi|428781724|ref|YP_007173510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]