SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428780221|ref|YP_007172007.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428780221|ref|YP_007172007.1|
Domain Number 1 Region: 543-623
Classification Level Classification E-value
Superfamily RuvA domain 2-like 8.26e-22
Family Excinuclease UvrC C-terminal domain 0.029
Further Details:      
 
Domain Number 2 Region: 24-109
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 2.88e-21
Family GIY-YIG endonuclease 0.0066
Further Details:      
 
Domain Number 3 Region: 200-252
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.000000000000183
Family C-terminal UvrC-binding domain of UvrB 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428780221|ref|YP_007172007.1|
Sequence length 623
Comment excinuclease ABC subunit C [Dactylococcopsis salina PCC 8305]
Sequence
MTTAVKPLIHHPEQLEARLQEIPMKPGVYFMRDRAGNIIYIGKSTKLRSRVRSYFRPSQA
LSEQKHIMVQQVAEIEFIVTDTEAEALALEANLVKQEQPYFNVLLKDDKKYPYLCITWSE
DYPRIFITRKRRRNNQKDRYYGPYVDTGALRRTLGLIKRTFPLRQRPRPLFKDRPCLNYD
LGRCPGVCQQLISPEDYRQTLQKVAMIFQGRSQELVRELTAKMKEAAANLEFEEAGKIRD
QIQSLQQLNANQKVSLPDDTVSRDAIAIVANSQHASIQLFQVRAGKLVGRLGFFADISPS
VSSEDILQRVVQDHYAVVDAVEIPSEILLPSAIPDQDLLSHWLTERKGGKVTFTIPQRQG
KAELMTMVEQNARYELERTQRAVNRNHQALQDLRDIIDLPETPRRIEGYDISHIQGSNAV
GSQVVFIDGIPAKQCYRRYKIKDTSVRSGHSDDFASLAEVIRRRFRKYVENPDLPRQEDS
EFPDLVMIDGGKGQLSAVVEQLQQMNLLEDVAVISLAKQREEIFLPGESFPLETDSEQPS
VQVLRRLRDEAHRFAVSFHRQQRTAKMQRSRLDDIPGLGFQRQQTLLAHFRSLEYIRQAS
LEQLQAVPGIGKALAQQIYDYFH
Download sequence
Identical sequences K9YWD5
WP_015229646.1.8022 gi|428780221|ref|YP_007172007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]