SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428780747|ref|YP_007172533.1| from Dactylococcopsis salina PCC 8305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428780747|ref|YP_007172533.1|
Domain Number 1 Region: 199-457
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.81e-16
Family Leukotriene A4 hydrolase catalytic domain 0.034
Further Details:      
 
Domain Number 2 Region: 480-574
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000025
Family HtrA-like serine proteases 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428780747|ref|YP_007172533.1|
Sequence length 594
Comment protease with the C-terminal PDZ domain [Dactylococcopsis salina PCC 8305]
Sequence
MTEATITQPKKVEETQAKLAYEVSFPEPQTHLFQVKLQVLGWENDTLKIQFPVWTPGSYL
VREYARHIQQLTAYNSEDNQPLSQEKQSKNTWLINSETTNSITIEYQVYANELTVRTNHL
DATHGYFNGAALFFDVPDLENSPIEVKIVPPAAHWKVTTSLPSVEGKINTYLAADFDTLV
DSPFEIGTHQVYDFQVLDKPHQLAIWGQGNANPEPIIQDIKKIVVTEAKIYKELPYDHYI
FLLHQAGSGFGGLEHKNCCSLIYPRFGFRATDKYNRFMQLVAHEFFHLWNIKRIRPKALE
AFDYSQENYTTALWFAEGTTSYYDALIPMRAGIYNARTCLDNLGKDITRFLKTPGRKVQP
LAESSFDAWIKLYRRDGNSDNNQISYYLKGELVSLLLDLLIRSRHNNHRSMDDVLLALWE
QFGKPEIGYTDEQLKSVLESVAESDLTPFLETYLYTTEELPLADYLQRFGLQLSSIEDDD
PIPDLGLRVATENGATKIKFVDADSPAGLAGIDAGDELLAMDGIRVNAEQLLDRSKDYQP
GDTVQLTVFHQDELLTHTLTFAPPQPDRYHISSIEEPSEAQKELLFGWLGVTTV
Download sequence
Identical sequences K9YW90
WP_015230166.1.8022 gi|428780747|ref|YP_007172533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]