SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0218753 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0218753
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 1.83e-60
Family CutC-like 0.00000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0218753   Gene: FBgn0191825   Transcript: FBtr0220261
Sequence length 259
Comment type=protein; loc=3R:10274869..10275648; ID=FBpp0218753; name=Dsim\GD20351-PA; parent=FBgn0191825,FBtr0220261; dbxref=FlyBase:FBpp0218753,FlyBase_Annotation_IDs:GD20351-PA,GB_protein:EDX12821,REFSEQ:XP_002103318,FlyMine:FBpp0218753; MD5=97e20409ff2d5095e47fe1fb22b74c8a; length=259; release=r1.3; species=Dsim;
Sequence
MSTHDIKLEVCVDSIRSAFAAEDGGASRIELCSALGEGGLTPSVGTLKTIKETLTIPIYC
MLRPRRGTDFVYSDEEMCALLTDMDLLRENGADGFVFGSLNPDRSINVDQCRHVLLASGG
LPVTFHRAFDLTDQKSMDENVDMLRELGFRRLLSSGFRPTAADGVDCLAQLIAKHQRDFI
VMPGAGIKVSNLEEILTVSRCLEFHASALDTAGEDYVAPTTTRMECDVTMGKQDVDPYYG
TNSIVVRKMVTIAKAMSSR
Download sequence
Identical sequences B4QYH6
FBpp0218753 XP_002103318.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]