SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0222746 from Drosophila simulans 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0222746
Domain Number 1 Region: 101-224
Classification Level Classification E-value
Superfamily Plus3-like 8.24e-33
Family Plus3 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0222746   Gene: FBgn0195691   Transcript: FBtr0224254
Sequence length 437
Comment type=protein; loc=2L:join(21645033..21646278,21646328..21646395); ID=FBpp0222746; name=Dsim\GD24344-PA; parent=FBgn0195691,FBtr0224254; dbxref=FlyBase:FBpp0222746,FlyBase_Annotation_IDs:GD24344-PA,GB_protein:EDX05777,REFSEQ:XP_002080192,FlyMine:FBpp0222746; MD5=ca6adf4ab442a7ab56872b62830bbe5d; length=437; release=r1.3; species=Dsim;
Sequence
MDERSRTRRKITKVRESGGKTAHAFERLLAIRNNKSSKEKCSEDRAEQTKASNDCQTQKR
TDLNIKVKETYSGDSSPNSERDNASQNDAQTKVESEECVSNLEQLSRAVLKRSDIKNLLD
KPIFAEAVIGSFVRLNVGKIYCIYETIALHQDRKDYRVDGKRTNLILVLRFGSEKRYSRI
DVVSNQPITQKEFLVWLESNLRNRCTLPTLNDIAKKQVQVKNACKYSYTETDVEKLIQAK
REAGKKQNAAYRKISLIIERDMAAGMNDVEKVQVLEKKILEIDQEPRTQIEKSGQHRYQV
LSSTRVVHVPTIYRHELGVPSGGKSSFDKRTAKPDQHELEKYMRRKYKKSAVVSRSRFKE
TFEDCGDSSAMVNKSHTENQKKEGDAETKAEKVTEEDLNLQRLNTFNIELDTTGLVPFHE
IFPNVKFNSPWDEIMKG
Download sequence
Identical sequences B4Q4V5
FBpp0222746 XP_002080192.1.80810 XP_016025832.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]