SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|350268416|ref|YP_004879722.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|350268416|ref|YP_004879722.1|
Domain Number - Region: 257-287,315-378
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.000358
Family N-acetylmuramoyl-L-alanine amidase-like 0.016
Further Details:      
 
Domain Number - Region: 148-219
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0298
Family YVTN repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|350268416|ref|YP_004879722.1|
Sequence length 388
Comment stage II sporulation protein P [Oscillibacter valericigenes Sjm18-20]
Sequence
MNTTAKKRNGPRRLWAMGLAVCTLWGVAVTAGSDTVVSAISALRREASAPLSALQWELGD
LGPEDGLSPAAVMTIAESPLLLSARETVAQLLSTETPDTPQEPVEQTPVEETPLDTSPLP
AENIPDNGVPAKTLVPTGDTGYTVSGKVYISNSTDHALTIQDLTTSFDAGLTDEEPQILI
IHTHGSEAYTPAAGVEVTYSGNHRTTDTRYNVVAVGDVMAQTFGELGISVLHDRTLYDYP
SYSGSYDRSLKAIESYLAQYPSIHFILDVHRDAIEDTDGNEYKVISPVEGAGNAAQVTIV
VGSDGSGLPHPNWMENLKLAVALQQDVTQMYPTMMRPILLRNSRYNQHATTGSLLLEIGA
AGNSPEEAALSGKLFAREMGEFLQAKCK
Download sequence
Identical sequences G4KQD4
WP_014115918.1.66763 gi|350268416|ref|YP_004879722.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]