SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|350269788|ref|YP_004881096.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|350269788|ref|YP_004881096.1|
Domain Number - Region: 141-162
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0871
Family Rubredoxin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|350269788|ref|YP_004881096.1|
Sequence length 164
Comment hypothetical protein OBV_13920 [Oscillibacter valericigenes Sjm18-20]
Sequence
MRFENRQCILSPTNPIRELKFRGYSAKAQDMKGVFSMALEFLNDLGKKAQAVAAVAADKA
KDAAELAKINMAIAGEQREMDKNYRTIGEWYVSEYSGEIPPAVKDLVDAVMASKAKIAEL
ESSKPMKDDAAEPAQAQPASKTCPICGAVSDSKFCPQCGAPMGE
Download sequence
Identical sequences G4KXY6
gi|350269788|ref|YP_004881096.1| WP_014117271.1.66763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]