SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|350270035|ref|YP_004881343.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350270035|ref|YP_004881343.1|
Domain Number 1 Region: 8-203,305-392
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.49e-75
Family Bacterial dinuclear zinc exopeptidases 0.0000102
Further Details:      
 
Domain Number 2 Region: 191-299
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.27e-24
Family Bacterial exopeptidase dimerisation domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|350270035|ref|YP_004881343.1|
Sequence length 400
Comment peptidase M20D family protein [Oscillibacter valericigenes Sjm18-20]
Sequence
MNDIGSKVRSLMKEMEPVFIEDFKYLHQHPEKSFEEFETTAFIKKRLTSLGITIMDHGMK
TGVVGLLKGATDGPCIALRADIDGLPVEEMSSCSFPSQNKGYMHACGHDTHASSLLAAAR
ILAACKEDLQGSVKFLFQPAEEVNFGAKEMMKHKVLENPKVDALFGLHNSPEIPIGTIAV
KNGPLMAAVNRINITITGSGGHGGVPQRNIDPIVCAASIILSTQTIVSRNLSPFAPCVVS
ICNVRAGEGTTNNVTPNEVTMYGTVRAFQTEDIDLIEKRLGSIIQYTCEAFGCKGNLEFI
RELDVTGSKELYDIALKAVKETGAQPVDPTPSTGGEDFSVYQKGNVPCFFYWLGTRNEKQ
DCVYSWHSPKFKADPHCIMIGGGVYTMSVFKAIEKFKAEN
Download sequence
Identical sequences G4KZK4
gi|350270035|ref|YP_004881343.1| WP_014117514.1.66763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]