SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|350270304|ref|YP_004881612.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350270304|ref|YP_004881612.1|
Domain Number 1 Region: 311-504
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.39e-67
Family B3/B4 domain of PheRS, PheT 0.00000475
Further Details:      
 
Domain Number 2 Region: 572-791
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.47e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00031
Further Details:      
 
Domain Number 3 Region: 38-156
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.81e-26
Family Myf domain 0.0041
Further Details:      
 
Domain Number 4 Region: 800-898
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.18e-25
Family Anticodon-binding domain of PheRS 0.00071
Further Details:      
 
Domain Number 5 Region: 513-580
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.58e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.001
Further Details:      
 
Domain Number 6 Region: 1-38,261-295
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000458
Family Domains B1 and B5 of PheRS-beta, PheT 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|350270304|ref|YP_004881612.1|
Sequence length 898
Comment phenylalanyl-tRNA synthetase beta chain [Oscillibacter valericigenes Sjm18-20]
Sequence
MLLSRKWLNEFVEVDASDRDFAEAMTLSGSKQEVTTDLGAGMKNVVVGKIVEMKKHPDSD
HMWVCQLDMGKSAPTQIVTGAWNIHVGDLVPVAKHNSLLPGRVKIERGLLRGVESDGMLC
SLKELGLTAEHDYPYAVIQAAAILGDYTPLKGQSPSIPANIQPGGKIFGKVIAAEVSTVA
TDGYACNVKLNTGSGFAEIFESPFQNLHEGDLVAYDPEHGILSLADLHAQQSEFPHCISD
GIWVILDTCKPGDDVAKLIGYDDHVVEFEITPNRPDCLSVIGLAREAAATFRKSLKLHTP
EIRGCGGSIAELVDIEIEDPELCPRYTARMVKNVKIKPSPAWMRERLRNSGVRPINNIVD
ITNYVMLEYGQPMHAFDFSCVEGGKIIVRTAREGETIQTLDGNQRKLTTSMLCICDERKP
VCVAGVMGGANSEIVGDTAQVLFESANFNGASVRRTALALNMRSEASSRYEKGLDPMNTM
KAVQRACELVELLGAGEVVDGVMDVIAKDAAPATVKLEPERINALLGTDVPEAEMRTILE
KLDFRLDGDVITVPSWRSDVEGMADIAEEVARFHGYNNIPITLMGGASAQGGYTPIQQAE
RTAGALCRSLGYDEIITYSFISPTYYDKINLPADSPLRNSLKILNPLGEDTSIMRTTTLP
SMLEILTRNYNFRNKSAYLYELGRTYFAKETGPDASGVAEEPKVLSLGAYGPDVDFFSLK
GAVETILEGLRIDGAVFEAVTGNPSYHPGRCARVLLGEKELGVFGQIHPDVAVNYGVDCE
LYAAELSFDALFAAMGPLPIYHALPKFPAVARDIAVVCDKSVTVGALEACIRRGAKGLLK
EVSLFDIYTGAGIALGRKSVAFNLTLRADDRSLTAAEADEDVSSILSLLKSELGAVLR
Download sequence
Identical sequences G4L0S8
gi|350270304|ref|YP_004881612.1| WP_014117775.1.66763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]