SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|350270572|ref|YP_004881880.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350270572|ref|YP_004881880.1|
Domain Number 1 Region: 48-235
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.39e-36
Family N-acetylmuramoyl-L-alanine amidase-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|350270572|ref|YP_004881880.1|
Sequence length 241
Comment putative N-acetylmuramoyl-L-alanine amidase [Oscillibacter valericigenes Sjm18-20]
Sequence
MVVLIRKTHLGLSALLLAAVAGMALILWQGSGSITTFSSLTGGEPSPIVVVDPGHGGEDG
GAVAADGTVESGLNLQIAQRLNDLLRFLGQVTVMTRTEDVSIYSDGAETLHQKKVSDLKN
RVALVNGLEDAVLVSIHQNSLPGSPKTHGAQVFYNGLEPAPALAATVQERLNQSINTGNG
KTPKRISDSIYLTKNVTAPAIIVECGFLSNGEDTAHLQEPGYQLQLAVAVAAGYLSTEET
P
Download sequence
Identical sequences G4KP61
gi|350270572|ref|YP_004881880.1| WP_014118036.1.66763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]