SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|350271227|ref|YP_004882535.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350271227|ref|YP_004882535.1|
Domain Number 1 Region: 4-182,338-433
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.54e-48
Family Bacterial dinuclear zinc exopeptidases 0.003
Further Details:      
 
Domain Number 2 Region: 182-222,255-304
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000000000464
Family Bacterial exopeptidase dimerisation domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|350271227|ref|YP_004882535.1|
Sequence length 458
Comment peptidase M20 family protein [Oscillibacter valericigenes Sjm18-20]
Sequence
MNFDAIKSAAKGYEADMTKFLRNLIAIPSESCEEEGVIRRIAAEMEKVGFDKVEIDGEGN
VLGWMGHGEKIIAYDAHIDTVGIGNRKNWKFDPYEGYETDTEIGGRGGSDQEGGIVSSVY
GAKIMKEQGLIPDDVTILVTGTVQEEDCDGLCWQYIHNEDKITPEFVVSTEPTDGGIYRG
HRGRMEIRVDVHGVSCHGSAPERGDNAIFKMADILQDVRALNENGDGPSNEVKGLVKMLN
PAFNPEHYEDAQFLGRGTVTVSQIFYTSPSRCAVADSCAVSLDRRMTAGETWDSCIKEIE
NLPSVKKYAKDVKVSMYMYDRPAWTGLKYETECYFPTWINKETAPHVQALVDAHKAMFGE
RRVGRPSSSEAAEKRKAPLIDKWTFSTNGVSIQGRYGIPCVGFGPGAESQAHAPNEITWK
EDLVECAAVYAAVPSLYKGKGSEDVCEYRGGKTNNDIK
Download sequence
Identical sequences G4KS13
WP_014118672.1.66763 gi|350271227|ref|YP_004882535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]