SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|350271878|ref|YP_004883186.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350271878|ref|YP_004883186.1|
Domain Number 1 Region: 2-242
Classification Level Classification E-value
Superfamily Hsp33 domain 7.59e-66
Family Hsp33 domain 0.00000295
Further Details:      
 
Domain Number 2 Region: 233-289
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 1.16e-16
Family HSP33 redox switch-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|350271878|ref|YP_004883186.1|
Sequence length 294
Comment 33 kDa chaperonin [Oscillibacter valericigenes Sjm18-20]
Sequence
MSDKIVRAISTDGFVKAAAVSTRDLTERARNIHHTLPVATAALGRALAAASMMGNALKED
GASVSLQFRGGGPLGTVLAVSDNEGNVRGTVDHPETDLPLRADGKLDVGGAVGREGTLTV
IRDLNMKEPYVGSVELMGGEIAEDLAAYFVESEQIPTACGLGVLVNRDQSVKTAGGYLVQ
LLPGAGEDAISRVEGSLLAAGAVTALLEKYPDPVELLRAALPDFKLELLEESPVEYRCTC
SKERMERALISMGAAELRSLIDEKGGAELTCRFCDRVQTFTKAELEVLLSAAKH
Download sequence
Identical sequences G4KVP8
WP_014119296.1.66763 gi|350271878|ref|YP_004883186.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]